EGLN2 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-EGLN2 antibody: synthetic peptide directed towards the N terminal of human EGLN2. Synthetic peptide located within the following region: MCLPSPSKPTSLHPCQAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLN |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 16 kDa |
| Gene Name | egl-9 family hypoxia inducible factor 2 |
| Database Link | |
| Background | The hypoxia inducible factor (HIF) is a transcriptional complex which is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. EGLN2 encodes an enzyme responsible for this posttranslational modification. Alternative splicing of EGLN2 results in three transcript variants encoding different isoforms. |
| Synonyms | EIT6; HIF-PH1; HIFPH1; HPH-1; HPH-3; PHD1 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Sheep: 86% |
| Reference Data | |
| Protein Categories | Growth Factors, Intracellular Proteins |
| Protein Families | Druggable Genome |
| Protein Pathways | Pathways in cancer, Renal cell carcinoma |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Hypoxia-inducible factor prolyl-4-hydroxylase-1 is a convergent point in the reciprocal negative regulation of NF-κB and p53 signaling pathways
Ullah, Rosendahl, Izzi et al
Sci Rep (2017) 7 (1), 17220 DOI: 10.1038/s41598-017-17376-0
Ullah, Rosendahl, Izzi et al
Sci Rep (2017) 7 (1), 17220 DOI: 10.1038/s41598-017-17376-0
AI Summary: OriGene’s HIF-P4H-1 antibody (TA337938) was used in Western blotting to specifically confirm the absence of functional HIF-P4H-1 protein in the study.
Snippet: The lack of functional HIF-P4H-1 was confirmed also by Western blotting with a HIF-P4H-1 antibody (TA337938, Origene) that recognizes specifically an epitope coded by exon 3 (supplementary Fig. 1f)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
