LIX1 Rabbit Polyclonal Antibody

SKU TA337847

Rabbit Polyclonal Anti-LIX1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LIX1 antibody: synthetic peptide directed towards the N terminal of human LIX1. Synthetic peptide located within the following region: TLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMES
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: limb and CNS expressed 1
• Database Link:
  NP_694966
  Q8N485
• Background: The specific function of this protein remains unknown.
• Synonyms: C5orf11; Lft
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 85%

Reference Data