LIX1 (NM_153234) Human Recombinant Protein

SKU
TP306319
Recombinant protein of human Lix1 homolog (chicken) (LIX1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206319 protein sequence
Red=Cloning site Green=Tags(s)

MDITLESLRHIIAQVLPHRDPALVFKDLNVVSMLQEFWESKQQQKAAFPSEGVVVYESLPAPGPPFVSYV
TLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMESVQEAVASTSGTLDDADDPST
SVGAYHYMLESNMGKTMLEFQELMTIFQLLHWNGSLKALRETKCSRQEVISYYSQYSLDEKMRSHMALDW
IMKERDSPGIVSQELRMALRQLEEARKAGQELRFYKEKKEILSLALTQICSDPDTSSPSDDQLSLTALCG
YH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 31.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_694966
Locus ID 167410
UniProt ID Q8N485
Cytogenetics 5q15
RefSeq Size 3979
RefSeq ORF 846
Synonyms C5orf11; Lft
Write Your Own Review
You're reviewing:LIX1 (NM_153234) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306319 LIX1 MS Standard C13 and N15-labeled recombinant protein (NP_694966) 10 ug
$3,255.00
LC407158 LIX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407158 Transient overexpression lysate of Lix1 homolog (chicken) (LIX1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.