TCTE1 Rabbit Polyclonal Antibody

SKU TA337596

Rabbit Polyclonal Anti-TCTE1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TCTE1 antibody: synthetic peptide directed towards the middle region of human TCTE1. Synthetic peptide located within the following region: MNFEWNLFLFTYRDCLSLAAAIKACHTLKIFKLTRSKVDDDKARIIIRSL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 56 kDa
• Gene Name: t-complex-associated-testis-expressed 1
• Database Link:
  NP_872345
  Q5JU00
• Background: TCTE1 contains 7 LRR (leucine-rich) repeats. The exact function of TCTE1 remains unknown.
• Synonyms: D6S46; DRC5; FAP155
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Rabbit: 86%; Guinea pig: 79%

Reference Data