TCTE1 (NM_182539) Human Recombinant Protein

  • Product Brand Image
SKU
TP306214
Recombinant protein of human t-complex-associated-testis-expressed 1 (TCTE1), 20 µg
In Control Promo
  $867.00
In Stock*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206214 protein sequence
Red=Cloning site Green=Tags(s)

MQDTVTTSALLDPSHSSVSTQDNSSTGGHTSSTSLQLSKPSITPVPAKSRNPRPRANIRRMRRIIAEDPE
WSLAIVPLLTELCIQHIIRNFQKNPILKQMLPEHQQKVLNHLSPDLPLAVTANLIDSENYWLRCCMHRWP
VCHVAHHGGSWKRMFFERHLENLLKHFIPGTTDPAVILDLLPLCRNYVRRVHVDQFLPPVQLPAQLRPGD
QSDSGSEGEMEEPTVDHYQLGDLVAGLSHLEELDLVYDVKDCGMNFEWNLFLFTYRDCLSLAAAIKACHT
LKIFKLTRSKVDDDKARIIIRSLLDHPVLEELDLSQNLIGDRGARGAAKLLSHSRLRVLNLANNQVRAPG
AQSLAHALAHNTNLISLNLRLNCIEDEGGQALAHALQTNKCLTTLHLGGNELSEPTATLLSQVLAINTTL
TSINLSCNHIGLDGGKQLLEGMSDNKTLLEFDLRLSDVAQESEYLIGQALYANREAARQRALNPSHFMST
ITANGPENSVG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 55.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_872345
Locus ID 202500
UniProt ID Q5JU00
Cytogenetics 6p21.1
RefSeq Size 1686
RefSeq ORF 1503
Synonyms D6S46; DRC5; FAP155
Summary Component of the nexin-dynein regulatory complex (N-DRC) a key regulator of ciliary/flagellar motility which maintains the alignment and integrity of the distal axoneme and regulates microtubule sliding in motile axonemes. May play a role in the assembly of N-DRC. May be required for sperm motility.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "TCTE1" proteins (3)
SKU Description Size Price
PH306214 TCTE1 MS Standard C13 and N15-labeled recombinant protein (NP_872345) 10 ug
$3,360.00
LC405494 TCTE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405494 Transient overexpression lysate of t-complex-associated-testis-expressed 1 (TCTE1) 100 ug
$436.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.