CLEC18B Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-CLEC18B Antibody is: synthetic peptide directed towards the C-terminal region of Human CLEC18B. Synthetic peptide located within the following region: DLRIDGDCFMVSSEADTYYRARMKCQRKGGVLAQIKSQKVQDILAFYLGR |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 49 kDa |
| Gene Name | C-type lectin domain family 18 member B |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | MRCL2 |
| Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93% |
| Reference Data | |
| Protein Categories | Secreated Proteins |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Overexpression of CLEC18B Associates With the Proliferation, Migration, and Prognosis of Glioblastoma
Guo, Zhao, Li et al
ASN Neuro (2018) 10, 1759091418781949 DOI: 10.1177/1759091418781949
Guo, Zhao, Li et al
ASN Neuro (2018) 10, 1759091418781949 DOI: 10.1177/1759091418781949
AI Summary: In this study, the CLEC18B antibody from OriGene Technologies was used for Western blot analysis to assess CLEC18B protein levels in glioblastoma cells, helping to elucidate its role in tumor proliferation and prognosis.
Snippet: Equal amount (20 lg/lane) of protein samples were separated by 10% to 12% sodium dodecyl sulfate-polyacrylamide gel electrophoresis and then transferred onto polyvinylidene fluoride membranes. The membranes were incubated overnight with the primary antibodies including CLEC18B (1:1000;OriGene Technologies Inc., Rockville, MD, USA), nucleus b-catenin (1:1000), Histone (1:1000), C-Myc (1:1000), and Cyclin D1 (1:1000;Cell Signaling Technology, Danvers, MA, USA)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
