PLD3 Rabbit Polyclonal Antibody

CAT#: TA336040

Rabbit Polyclonal Anti-PLD3 Antibody

Product Images

WB Suggested Anti-PLD3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human heart

• 

  Host: Rabbit; Target Name: PLD3; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PLD3 Antibody: synthetic peptide directed towards the N terminal of human PLD3. Synthetic peptide located within the following region: WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: phospholipase D family member 3
• Database Link:
  NP_001026866
  Entrez Gene 23646 Human
  UniProt ID Q8IV08
• Background: PLD3 is a ingle-pass type II membrane protein. It belongs to the phospholipase D family. PLD3 contains 2 PLD phosphodiesterase domains. The exact function of PLD3 remains unknown.
• Synonyms: AD19; HU-K4; HUK4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane