PLD3 (NM_001031696) Human Recombinant Protein

SKU
TP306783
Recombinant protein of human phospholipase D family, member 3 (PLD3), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206783 protein sequence
Red=Cloning site Green=Tags(s)

MKPKLMYQELKVPAEEPANELPMNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGP
NQRPAPCYDPCEAVLVESIPEGLDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPS
AQQGEEVLRQLQTLAPKGVNVRIAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTHGVLHTKFWVVDQT
HFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRFYDTRYNQETPME
ICLNGTPALAYLASAPPPLCPSGRTPDLKALLNVVDNARSFIYVAVMNYLPTLEFSHPHRFWPAIDDGLR
RATYERGVKVRLLISCWGHSEPSMRAFLLSLAALRDNHTHSDIQVKLFVVPADEAQARIPYARVNHNKYM
VTERATYIGTSNWSGNYFTETAGTSLLVTQNGRGGLRSQLEAIFLRDWDSPYSHDLDTSADSVGNACRLL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001026866
Locus ID 23646
UniProt ID Q8IV08
Cytogenetics 19q13.2
RefSeq Size 2207
RefSeq ORF 1470
Synonyms AD19; HU-K4; HUK4; SCA46
Summary This gene encodes a member of the phospholipase D (PLD) family of enzymes that catalyze the hydrolysis of membrane phospholipids. The encoded protein is a single-pass type II membrane protein and contains two PLD phosphodiesterase domains. This protein influences processing of amyloid-beta precursor protein. Mutations in this gene are associated with Alzheimer disease risk. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Apr 2014]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:PLD3 (NM_001031696) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306783 PLD3 MS Standard C13 and N15-labeled recombinant protein (NP_001026866) 10 ug
$3,255.00
LC400411 PLD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415872 PLD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429360 PLD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400411 Transient overexpression lysate of phospholipase D family, member 3 (PLD3), transcript variant 1 100 ug
$436.00
LY415872 Transient overexpression lysate of phospholipase D family, member 3 (PLD3), transcript variant 2 100 ug
$436.00
LY429360 Transient overexpression lysate of phospholipase D family, member 3 (PLD3), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.