PLD3 (NM_001031696) Human Mass Spec Standard

SKU
PH306783
PLD3 MS Standard C13 and N15-labeled recombinant protein (NP_001026866)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206783]
Predicted MW 54.7 kDa
Protein Sequence
Protein Sequence
>RC206783 protein sequence
Red=Cloning site Green=Tags(s)

MKPKLMYQELKVPAEEPANELPMNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGP
NQRPAPCYDPCEAVLVESIPEGLDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPS
AQQGEEVLRQLQTLAPKGVNVRIAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTHGVLHTKFWVVDQT
HFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRFYDTRYNQETPME
ICLNGTPALAYLASAPPPLCPSGRTPDLKALLNVVDNARSFIYVAVMNYLPTLEFSHPHRFWPAIDDGLR
RATYERGVKVRLLISCWGHSEPSMRAFLLSLAALRDNHTHSDIQVKLFVVPADEAQARIPYARVNHNKYM
VTERATYIGTSNWSGNYFTETAGTSLLVTQNGRGGLRSQLEAIFLRDWDSPYSHDLDTSADSVGNACRLL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001026866
RefSeq Size 2207
RefSeq ORF 1470
Synonyms AD19; HU-K4; HUK4; SCA46
Locus ID 23646
UniProt ID Q8IV08
Cytogenetics 19q13.2
Summary This gene encodes a member of the phospholipase D (PLD) family of enzymes that catalyze the hydrolysis of membrane phospholipids. The encoded protein is a single-pass type II membrane protein and contains two PLD phosphodiesterase domains. This protein influences processing of amyloid-beta precursor protein. Mutations in this gene are associated with Alzheimer disease risk. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Apr 2014]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:PLD3 (NM_001031696) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400411 PLD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415872 PLD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429360 PLD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400411 Transient overexpression lysate of phospholipase D family, member 3 (PLD3), transcript variant 1 100 ug
$436.00
LY415872 Transient overexpression lysate of phospholipase D family, member 3 (PLD3), transcript variant 2 100 ug
$436.00
LY429360 Transient overexpression lysate of phospholipase D family, member 3 (PLD3), transcript variant 2 100 ug
$436.00
TP306783 Recombinant protein of human phospholipase D family, member 3 (PLD3), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.