SMPDL3B Rabbit Polyclonal Antibody

CAT#: TA334676

Rabbit Polyclonal Anti-SMPDL3B Antibody

Product Images

WB Suggested Anti-SMPDL3B Antibody Titration: 0.2-1 ug/ml; Positive Control: Raji cell lysate SMPDL3B is supported by BioGPS gene expression data to be expressed in Raji

• 

  Human Intestine

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SMPDL3B antibody: synthetic peptide directed towards the N terminal of human SMPDL3B. Synthetic peptide located within the following region: ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: sphingomyelin phosphodiesterase acid like 3B
• Database Link:
  NP_055289
  Entrez Gene 27293 Human
  UniProt ID Q92485
• Background: Located on chromosome 1, this gene encodes for acid sphingomyelinase-like phosphodiesterase 3b precursor protein.
• Synonyms: ASML3B
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Horse: 92%; Rabbit: 92%; Dog: 85%; Rat: 85%; Mouse: 85%; Bovine: 85%; Zebrafish: 85%

Reference Data

• Protein Families: Secreted Protein