SMPDL3B (NM_001009568) Human Recombinant Protein

SKU
TP304846
Recombinant protein of human sphingomyelin phosphodiesterase, acid-like 3B (SMPDL3B), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204846 protein sequence
Red=Cloning site Green=Tags(s)

MRLLAWLIFLANWGGARAEPGKFWHIADLHLDPDYKVSKDPFQVCPSAGSQPVPDAGPWGDYLCDSPWAL
INSSIYAMKEIEPEPDFILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDFHPK
NQFPAGSNNIYNQIAELWKPWLSNESIALFKKGAFYCEKLPGPSGAGRIVVLNTNLYYTSNALTADMADP
GQQFQWLEDVLTDASKAGDMVYIVGHVPPGFFEKTQNKAWFREGFNEKYLKVVRKHHRVIAGQFFGHHHT
DSFRMLYDDAGVPISAMFITPGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKVRSPAEARGGGWEGL
KCITTFPHSQLIHLPLTTEPQEG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 41.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001009568
Locus ID 27293
UniProt ID Q92485
Cytogenetics 1p35.3
RefSeq Size 1611
RefSeq ORF 1119
Synonyms ASML3B
Summary Lipid-modulating phosphodiesterase (PubMed:26095358). Active on the surface of macrophages and dendritic cells and strongly influences macrophage lipid composition and membrane fluidity. Acts as a negative regulator of Toll-like receptor signaling (By similarity). Has in vitro phosphodiesterase activity, but the physiological substrate is unknown (PubMed:26095358). Lacks activity with phosphocholine-containing lipids, but can cleave CDP-choline, and can release phosphate from ATP and ADP (in vitro) (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:SMPDL3B (NM_001009568) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304846 SMPDL3B MS Standard C13 and N15-labeled recombinant protein (NP_001009568) 10 ug
$3,255.00
LC415256 SMPDL3B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422916 SMPDL3B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429425 SMPDL3B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415256 Transient overexpression lysate of sphingomyelin phosphodiesterase, acid-like 3B (SMPDL3B), transcript variant 1 100 ug
$665.00
LY422916 Transient overexpression lysate of sphingomyelin phosphodiesterase, acid-like 3B (SMPDL3B), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.