ECH1 Rabbit Polyclonal Antibody

CAT#: TA332137

Rabbit Polyclonal Anti-ECH1 Antibody

Product Images

WB Suggested Anti-ECH1 Antibody Titration: 2.5ug/ml; Positive Control: HepG2 cell lysate; ECH1 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ECH1 Antibody: synthetic peptide directed towards the N terminal of human ECH1. Synthetic peptide located within the following region: PDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: enoyl-CoA hydratase 1, peroxisomal
• Database Link:
  NP_001389
  Entrez Gene 1891 Human
  UniProt ID Q13011
• Background: ECH1 is a member of the hydratase/isomerase superfamily. ECH1 shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The protein contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway.This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators.
• Synonyms: HPXEL
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 92%; Rabbit: 86%