PUS7L Rabbit Polyclonal Antibody

CAT#: TA331702

Reviews ()
Write a review

Rabbit Polyclonal Anti-PUS7L Antibody


 Product Datasheet for 'TA331702'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PUS7L Antibody is: synthetic peptide directed towards the N-terminal region of Human PUS7L. Synthetic peptide located within the following region: QSGSEKEDTIVDGTSKCEEKADVLSSFLDEKTHELLNNFACDVREKWLSK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Predicted Protein Size 80 kDa
Gene Name pseudouridylate synthase 7 like
Background The function of this protein remains unknown.
Note Immunogen sequence homology: Human: 100%
Reference Data
Other products for "PUS7L"
Frequently bought together (2)
Transient overexpression lysate of pseudouridylate synthase 7 homolog (S. cerevisiae)-like (PUS7L), transcript variant 3
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
BOGO Free lysates
68 Mouse Clones