PUS7L (NM_031292) Human Recombinant Protein

SKU
TP309780
Recombinant protein of human pseudouridylate synthase 7 homolog (S. cerevisiae)-like (PUS7L), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209780 protein sequence
Red=Cloning site Green=Tags(s)

MEEDTDYRIRFSSLCFFNDHVGFHGTIKSSPSDFIVIEIDEQGQLVNKTIDEPIFKISEIQLEPNNFPKK
PKLDLQNLSLEDGRNQEVHTLIKYTDGDQNHQSGSEKEDTIVDGTSKCEEKADVLSSFLDEKTHELLNNF
ACDVREKWLSKTELIGLPPEFSIGRIVDKNQRASLHSAIRQKFPFLVTVGKNSEIVVKPNLEYKELCHLV
SEEEAFDFFKYLDAKKENSKFTFKPDTNKDHRKAVHHFVNKKFGNLVETKSFSKMNCSAGNPNVVVTVRF
REKAHKRGKRPLSECQEGKVIYTAFTLRKENLEMFEAIGFLAIKLGVIPSDFSYAGLKDKKAITYQAMVV
RKVTPERLKNIEKEIEKKRMNVFNIRSVDDSLRLGQLKGNHFDIVIRNLKKQINDSANLRERIMEAIENV
KKKGFVNYYGPQRFGKGRKVHTDQIGLALLKNEMMKAIKLFLTPEDLDDPVNRAKKYFLQTEDAKGTLSL
MPEFKVRERALLEALHRFGMTEEGCIQAWFSLPHSMRIFYVHAYTSKIWNEAVSYRLETYGARVVQGDLV
CLDEDIDDENFQNSKIHLVTEEEGSANMYAIHQVVLPVLGYNIQYPKNKVGQWYHDILSRDGLQTCRFKV
PTLKLNIPGCYRQILKHPCNLSYQLMEDHDIDVKTKGSHIDETALSLLISFDLDASCYATVCLKEIMKHD
V

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 80.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_112582
Locus ID 83448
UniProt ID Q9H0K6
Cytogenetics 12q12
RefSeq Size 3985
RefSeq ORF 2103
Summary Pseudouridylate synthase that catalyzes pseudouridylation of RNAs.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PUS7L (NM_031292) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309780 PUS7L MS Standard C13 and N15-labeled recombinant protein (NP_112582) 10 ug
$3,255.00
LC410566 PUS7L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420641 PUS7L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420642 PUS7L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410566 Transient overexpression lysate of pseudouridylate synthase 7 homolog (S. cerevisiae)-like (PUS7L), transcript variant 3 100 ug
$436.00
LY420641 Transient overexpression lysate of pseudouridylate synthase 7 homolog (S. cerevisiae)-like (PUS7L), transcript variant 2 100 ug
$665.00
LY420642 Transient overexpression lysate of pseudouridylate synthase 7 homolog (S. cerevisiae)-like (PUS7L), transcript variant 1 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.