ADAT2 Rabbit Polyclonal Antibody

SKU TA331368

Rabbit Polyclonal Anti-ADAT2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ADAT2 antibody is: synthetic peptide directed towards the C-terminal region of Human ADAT2. Synthetic peptide located within the following region: NIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKEC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 16 kDa
• Gene Name: adenosine deaminase, tRNA specific 2
• Database Link:
  NP_872309
  Q7Z6V5
• Background: ADAT2 is probably participates in deamination of adenosine-34 to inosine in many tRNAs.
• Synonyms: DEADC1; dJ20N2; dJ20N2.1; TAD2
• Note: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Zebrafish: 92%

Reference Data