ADAT2 (NM_182503) Human Recombinant Protein

SKU TP312395

Recombinant protein of human adenosine deaminase, tRNA-specific 2, TAD2 homolog (S. cerevisiae) (ADAT2), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212395 representing NM_182503; Red=Cloning site Green=Tags(s); ; MEAKAAPKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATR; HAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNI; ASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_872309
• Locus ID: 134637
• UniProt ID: Q7Z6V5
• Cytogenetics: 6q24.2
• RefSeq Size: 6270
• RefSeq ORF: 573
• Synonyms: DEADC1; dJ20N2; dJ20N2.1; TAD2
• Summary: Probably participates in deamination of adenosine-34 to inosine in many tRNAs.[UniProtKB/Swiss-Prot Function]