TRAPPC6A Rabbit Polyclonal Antibody

CAT#: TA330728

Rabbit Polyclonal Anti-TRAPPC6A Antibody

Product Images

Host: Rabbit; Target Name: TRAPPC6A; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TRAPPC6A antibody is: synthetic peptide directed towards the N-terminal region of Human TRAPPC6A. Synthetic peptide located within the following region: HDPDPGPGVSAGLRGEEAGATKGQKMSLSVLEGMGFRVGQALGERLPRET
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: trafficking protein particle complex 6A
• Database Link:
  NP_077013
  Entrez Gene 79090 Human
  UniProt ID O75865
• Background: This gene encodes a component of the trafficking protein particle complex, which tethers transport vesicles to the cis-Golgi membrane. Loss of expression of the related gene in mouse affects coat and eye pigmentation, suggesting that the encoded protein may be involved in melanosome biogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Synonyms: TRS33
• Note: Human: 100%