OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LTA (NM_000595) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303741
Recombinant protein of human lymphotoxin alpha (TNF superfamily, member 1) (LTA), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "LTA or NM_000595"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203741 protein sequence
Red=Cloning site Green=Tags(s)

MTPPERLFLPRVRGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGD
PSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSS
QYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000586
Locus ID 4049
UniProt ID P01374
Cytogenetics 6p21.33
RefSeq Size 1423
RefSeq ORF 615
Synonyms LT; TNFB; TNFSF1; TNLG1E
Summary The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4, myocardial infarction, non-Hodgkin's lymphoma, and psoriatic arthritis. Alternatively spliced transcript variants have been observed for this gene. provided by RefSeq, Jul 2012
Protein Categories Cardiovascular diseases, Cytokines, Secreated Proteins
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Antigen processing and presentation, Cytokine-cytokine receptor interaction, Type I diabetes mellitus
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LTA" proteins (7)
SKU Description Size Price
PH303741 LTA MS Standard C13 and N15-labeled recombinant protein (NP_000586) 10 ug
$3,360.00
LC424627 Lyophilized LTA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431786 Lyophilized LTA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424627 Transient overexpression lysate of lymphotoxin alpha (TNF superfamily, member 1) (LTA), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY431786 Transient overexpression lysate of lymphotoxin alpha (TNF superfamily, member 1) (LTA), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP328758 Recombinant protein of human lymphotoxin alpha (TNF superfamily, member 1) (LTA), transcript variant 1, 20 µg 20 ug
$737.00
TP720614 Purified recombinant protein of Human lymphotoxin alpha (TNF superfamily, member 1) (LTA), transcript variant 2 10 ug
$290.00

file-alt Citations

Plac1+ Tumor Cell-Treg Interplay Supports Tumorigenesis and Progression of Head and Neck Cancer
Meng, Liu, Zhao et al
Adv Sci (Weinh) (2025)
Cited by 9
AI Summary: OriGene’s recombinant human LTA protein (rhLTA, #TP303741) was used to treat HNSCC cells in vitro, enabling the authors to validate the malignancy-inducing effects and analyze activation of the PI3K/AKT pathway.
Snippet: Next, we validated these malignancy-inducing effects in vitro by adding rhLTA (Origene, #TP303741) into the medium of HNSCC cells. WB analysis of PI3K/AKT pathway
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products