CD48 (NM_001778) Human Recombinant Protein
Purified recombinant protein of Human CD48 molecule (CD48)
Product images

Specifications
Product Data | |
Description | Purified recombinant protein of Human CD48 molecule (CD48) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
Tag | C-Fc/His |
Predicted MW | 53.1 kDa |
Concentration | lot specific |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001769 |
Locus ID | 962 |
Refseq Size | 1155 |
Cytogenetics | 1q23.3 |
Refseq ORF | 729 |
Synonyms | BCM1; BLAST; BLAST1; hCD48; mCD48; MEM-102; SLAMF2 |
Summary | This gene encodes a member of the CD2 subfamily of immunoglobulin-like receptors which includes SLAM (signaling lymphocyte activation molecules) proteins. The encoded protein is found on the surface of lymphocytes and other immune cells, dendritic cells and endothelial cells, and participates in activation and differentiation pathways in these cells. The encoded protein does not have a transmembrane domain, however, but is held at the cell surface by a GPI anchor via a C-terminal domain which maybe cleaved to yield a soluble form of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Natural killer cell mediated cytotoxicity |
Documents
FAQs |
SDS |
Resources
Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419755 | CD48 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 110.00 |
|
LY419755 | Transient overexpression lysate of CD48 molecule (CD48) |
USD 360.00 |
|
TP723939 | Human CD48 Protein, mFc-His Tag |
USD 520.00 |
|
TP724011 | Human CD48 Protein, hFc Tag |
USD 520.00 |
|
TP750162 | Purified recombinant protein of Human fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) (FABP3),Val2-end, tag free, expressed in E. coli, 50ug |
USD 215.00 |
|
TP762106 | Purified recombinant protein of Human CD48 molecule (CD48),Gln27-Ser220, with N-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
USD 345.00