Csf1 (NM_023981) Rat Recombinant Protein

CAT#: TP721033

Csf1 (Myc-DDK-tagged ORF) - Rat colony stimulating factor 1 (macrophage) (Csf1), (10 ug)


 Product Datasheet for 'TP721033'

  View other "Csf1" proteins (3)

USD 299.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Description Csf1 (Myc-DDK-tagged ORF) - Rat colony stimulating factor 1 (macrophage) (Csf1), (10 ug)
Species Rat
Expression Host HEK293
Expression cDNA Clone or AA Sequence EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQRTEGSSLLPSDLPLRIEDPGSAKQRPPR
Tag Tag Free
Predicted MW 25.2kD
Concentration Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of PBS,pH7.4
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_076471
Locus ID 78965
Refseq Size 3975
Refseq ORF 1716

Documents

Other Versions

Other products for "Csf1"
Frequently bought together (1)
Rabbit Polyclonal MCSF Antibody
    • 100 ug

USD 409.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones