Csf1 (NM_023981) Rat Recombinant Protein

CAT#: TP721033

Reviews ()
Write a review

Csf1 (Myc-DDK-tagged ORF) - Rat colony stimulating factor 1 (macrophage) (Csf1), (10 ug)


Product Datasheet for 'TP721033'


  View other "Csf1" proteins (4)

USD 300.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Description Csf1 (Myc-DDK-tagged ORF) - Rat colony stimulating factor 1 (macrophage) (Csf1), (10 ug)
Species Rat
Expression Host HEK293
Expression cDNA Clone or AA Sequence EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQRTEGSSLLPSDLPLRIEDPGSAKQRPPR
Tag Tag Free
Predicted MW 25.2 kDa
Concentration Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of PBS,pH7.4
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Reference Data
RefSeq NP_076471
Locus ID 78965
Refseq Size 3975
Cytogenetics 2q34
Refseq ORF 1698
Summary plays a role in macrophage formation; involved in osteoclastogenesis and endochondral ossification [RGD, Feb 2006]

Documents

Other Versions

Other products for "Csf1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101