Id4 (NM_031166) Mouse Recombinant Protein

SKU TP527565

Purified recombinant protein of Mouse inhibitor of DNA binding 4 (Id4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR227565 representing NM_031166; Red=Cloning site Green=Tags(s); ; MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMND; CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPLHPAGACPVAPPRTPL; TALNTDPAGAVNKQGDSILCR; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 17 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_112443
• Locus ID: 15904
• UniProt ID: P41139
• Cytogenetics: 13 24.71 cM
• RefSeq Size: 1660
• RefSeq ORF: 483
• Synonyms: bHLHb27; Idb4
• Summary: Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation.[UniProtKB/Swiss-Prot Function]