OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Rs1 (NM_011302) Mouse Recombinant Protein

Be the first to review this product
SKU
TP527521
Purified recombinant protein of Mouse retinoschisis (X-linked, juvenile) 1 (human) (Rs1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Rs1 or NM_011302"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR227521 representing NM_011302
Red=Cloning site Green=Tags(s)

MPHKIEGFFLLLLFGYEATLGLSSTEDEGEDPWYQKACKCDCQVGANALWSAGATSLDCIPECPYHKPLG
FESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKYQDSSQWLQIDLKEIKVISGILTQG
RCDIDEWVTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRSSTVQNLLRPPIISRFIRLIPLGWHVRI
AIRMELLECASKCA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 26 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_035432
Locus ID 20147
UniProt ID Q9Z1L4
Cytogenetics X 73.95 cM
RefSeq Size 5855
RefSeq ORF 672
Synonyms Rs1h; tmgc1; Xlrs1
Summary Binds negatively charged membrane lipids, such as phosphatidylserine and phosphoinositides (PubMed:17325137, PubMed:20677810). May play a role in cell-cell adhesion processes in the retina, via homomeric interaction between octamers present on the surface of two neighboring cells (By similarity). Required for normal structure and function of the retina (PubMed:11983912, PubMed:17325137).UniProtKB/Swiss-Prot Function
Protein Categories Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products