OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Rasgrp2 (NM_011242) Mouse Recombinant Protein

Be the first to review this product
SKU
TP526786
Purified recombinant protein of Mouse RAS, guanyl releasing protein 2 (Rasgrp2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Rasgrp2 or NM_011242"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR226786 representing NM_011242
Red=Cloning site Green=Tags(s)

MTSTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLHFYQQSRKDNSNS
LQMKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIESVPTYKWKRQVTQRNPVE
QKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTHGCTVDNPVLERFISLFNSVSQWVQLM
ILSKPTATQRALVITHFVHVAERLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPDTIKLWEGLTELV
TATGNYSNYRRRLAACVGFRFPILGVHLKDLVALQLALPDWLDPGRTRLNGAKMRQLFCILEELAMVTSL
RPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSVAKPKLDQ
ALVAEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMISYFLRSSSV
LGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKERLSVECRRRAQSVSLEGS
APSPSPTHTHHRAFSFSLPRPGRRSSRPPEIREEEVQSVEDGVFDIHL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 69.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_035372
Locus ID 19395
UniProt ID Q9QUG9
Cytogenetics 19 A
RefSeq Size 2209
RefSeq ORF 1824
Synonyms Caldaggef1; CDC25L
Summary Functions as a calcium- and DAG-regulated nucleotide exchange factor specifically activating Rap through the exchange of bound GDP for GTP. May also activates other GTPases such as RRAS, RRAS2, NRAS, KRAS but not HRAS. Functions in aggregation of platelets and adhesion of T-lymphocytes and neutrophils probably through inside-out integrin activation. May function in the muscarinic acetylcholine receptor M1/CHRM1 signaling pathway.UniProtKB/Swiss-Prot Function
Protein Categories Cardiovascular diseases, Growth Factors, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Memory B Cells Activate Brain-Homing, Autoreactive CD4+ T Cells in Multiple Sclerosis
Jelcic, Al Nimer, Wang et al
Cell (2018) 175 (1), 85-100.e23 DOI: 10.1016/j.cell.2018.08.011
AI Summary: OriGene’s human recombinant RASGRP2 protein (Cat# TP312719) was used in this study to identify RASGRP2 as a target autoantigen involved in autoreactive T cell activation in multiple sclerosis.
Snippet: Proteinase K, recombinant Roche Cat# 03115879001 QIAzol lysis reagent QIAGEN Cat# 79306 RASGRP2 protein, human recombinant OriGene Cat# TP312719
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products