Spp1 (NM_009263) Mouse Recombinant Protein

CAT#: TP526579

Purified recombinant protein of Mouse secreted phosphoprotein 1 (Spp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Spp1 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR226579 representing NM_009263
  Red=Cloning site Green=Tags(s)
  
  MRLAVICFCLFGIASSLPVKVTDSGSSEEKLYSLHPDPIATWLVPDPSQKQNLLAPQNAVSSEEKDDFKQ
  ETLPSNSNESHDHMDDDDDDDDDDGDHAESEDSVDSDESDESHHSDESDETVTASTQADTFTPIVPTVDV
  PNGRGDSLAYGLRSKSRSFQVSDEQYPDATDEDLTSHMKSGESKESLDVIPVAQLLSMPSDQDNNGKGSH
  ESSQLDEPSLETHRLEHSKESQESADQSDVIDSQASSKASLEHQSHKFHSHKDKLVLDPKSKEDDRYLKF
  RISHELESSSSEVN
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 32.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_033289
• Locus ID: 20750
• UniProt ID: P10923, Q547B5
• Cytogenetics: 5 50.68 cM
• Refseq Size: 1410
• Refseq ORF: 882
• Synonyms: 2AR; Apl-1; BNSP; Bsp; BSPI; Eta; ETA-1; OP; Opn; Opnl; Ric; Spp-1
• Summary: Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction.[UniProtKB/Swiss-Prot Function]