Stmn1 (NM_019641) Mouse Recombinant Protein

CAT#: TP526557

Purified recombinant protein of Mouse stathmin 1 (Stmn1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR226557 representing NM_019641
  Red=Cloning site Green=Tags(s)
  
  MASSDIQVKELEKRASGQAFELILSPRSKESVPDFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLK
  QLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHVEEVRKNKESK
  DPADETEAD
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 17.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_062615
• Locus ID: 16765
• UniProt ID: P54227, Q545B6
• Cytogenetics: 4 66.76 cM
• Refseq Size: 1070
• Refseq ORF: 447
• Synonyms: 19k; Lag; Lap18; Op18; P18; P19; Pig; Pp17; Pp18; Pp19; Pr22; Smn
• Summary: Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis (By similarity). Involved in the control of the learned and innate fear.[UniProtKB/Swiss-Prot Function]