Gip (NM_008119) Mouse Recombinant Protein

CAT#: TP526309

Purified recombinant protein of Mouse gastric inhibitory polypeptide (Gip), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR226309 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVALKTCSLLLVLLFLAVGLGEKEEVEFRSHAKFAGPRPRGPRYAEGTFISDYSIAMDKIRQQDFVNWLL
  AQRGKKSDWKHNITQREARALVLAGQSQGKEDKEAQGSSLPKSLSDDDVLRDLLIQELLAWMVDQTELCR
  LRSQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 16.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032145
• Locus ID: 14607
• UniProt ID: P48756
• Cytogenetics: 11 D
• Refseq Size: 649
• Refseq ORF: 435
• Summary: This gene encodes an incretin hormone that belongs to the glucagon superfamily. The encoded preproprotein undergoes proteolytic processing to generate mature peptides that function as potent stimulators of insulin secretion and inhibit gastric acid secretion. Transgenic mice overexpressing the encoded protein exhibit a significant increase in the expression of markers of bone formation, a decrease in the expression of markers of bone resorption and, an increase in the bone mass. [provided by RefSeq, Nov 2015]