OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Gip (NM_008119) Mouse Recombinant Protein

Be the first to review this product
SKU
TP526309
Purified recombinant protein of Mouse gastric inhibitory polypeptide (Gip), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Gip or NM_008119"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR226309 protein sequence
Red=Cloning site Green=Tags(s)

MVALKTCSLLLVLLFLAVGLGEKEEVEFRSHAKFAGPRPRGPRYAEGTFISDYSIAMDKIRQQDFVNWLL
AQRGKKSDWKHNITQREARALVLAGQSQGKEDKEAQGSSLPKSLSDDDVLRDLLIQELLAWMVDQTELCR
LRSQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 16.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_032145
Locus ID 14607
UniProt ID P48756
Cytogenetics 11 D
RefSeq Size 649
RefSeq ORF 432
Summary This gene encodes an incretin hormone that belongs to the glucagon superfamily. The encoded preproprotein undergoes proteolytic processing to generate mature peptides that function as potent stimulators of insulin secretion and inhibit gastric acid secretion. Transgenic mice overexpressing the encoded protein exhibit a significant increase in the expression of markers of bone formation, a decrease in the expression of markers of bone resorption and, an increase in the bone mass. provided by RefSeq, Nov 2015
Protein Categories Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products