OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Runx1 (NM_009821) Mouse Recombinant Protein

Be the first to review this product
SKU
TP526250
Purified recombinant protein of Mouse runt related transcription factor 1 (Runx1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA355930 Runx1 Antibody - N-terminal region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Runx1 or NM_009821"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR226250 representing NM_009821
Red=Cloning site Green=Tags(s)

MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDGGAALASKLRSGDRSMVEVLADHPGELVRTDSPNF
LCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRS
GRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRNARQIQPSPPWSYDQSYQYLGSITSSSVHPATP
ISPGRASGMTSLSAELSSRLSTAPDLTAFGDPRQFPTLPSISDPRMHYPGAFTYSPPVTSGIGIGMSAMS
SASRYHTYLPPPYPGSSQAQAGPFQTGSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGAALL
NPSLPSQSDVVETEGSHSNSPTNMPPARLEEAVWRPY

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 41.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_033951
Locus ID 12394
UniProt ID G3X9W7
Cytogenetics 16 53.7 cM
RefSeq Size 6945
RefSeq ORF 1161
Synonyms AML1; CBF-alpha-2; Cbfa2; Pebp2a2; Pebpa2b
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Platelet protein kinase C-theta deficiency with human RUNX1 mutation: PRKCQ is a transcriptional target of RUNX1
Jalagadugula, Mao, Kaur et al
Arterioscler. Thromb. Vasc. Biol. (2011) 31 (4), 921-7 DOI: 10.1161/ATVBAHA.110.221879
Cited by 3
AI Summary: OriGene products, including the RUNX1 expression plasmid (RUNX1-pCMV6-XL4), empty vector (pCMV6-XL4), and the transfection agent Turbofectin 8.0, were used to manipulate RUNX1 expression in cell-based experiments, enabling the study of RUNX1's regulatory effect on PRKCQ transcription in megakaryocytic cells.
Snippet: Recombinant RUNX1 protein, RUNX1 expression plasmid RUNX1-pCMV6-XL4, empty expression vector pCMV6-XL4, and transfection agent Turbofectin 8.0 were from Origene Technologies (Rockville, MD). Cell Lines and Cell Culture.
Mechanism of platelet factor 4 (PF4) deficiency with RUNX1 haplodeficiency: RUNX1 is a transcriptional regulator of PF4
Aneja, Jalagadugula, Mao et al
J. Thromb. Haemost. (2011) 9 (2), 383-91 DOI: 10.1111/j.1538-7836.2010.04154.x
Cited by 53
AI Summary: OriGene's recombinant RUNX1 protein was used in binding assays to study the interaction between RUNX1 and the PF4 promoter, helping to demonstrate RUNX1's role as a transcriptional regulator of PF4 in this study.
Snippet: In addition, we studied the binding of recombinant RUNX1 (200 ng) (Origene, Rockville, MD, USA) to PF4 probes, using buffer containing 0.3 mm HEPES, 0.5 mm dithiothreitol, 0.005% Triton X-100, 100 mm NaCl, 0.5 μg μL −1 bovine serum albumin, 10% glycerol and 5 mm
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products