Cd70 (NM_011617) Mouse Recombinant Protein

CAT#: TP525924

Purified recombinant protein of Mouse CD70 antigen (Cd70), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR225924 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPEEGRPCPWVRWSGTAFQRQWPWLLLVVFITVFCCWFHCSGLLSKQQQRLLEHPEPHTAELQLNLTVPR
  KDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAH
  GISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 21.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_035747
• Locus ID: 21948
• UniProt ID: O55237, Q05A52
• Cytogenetics: 17 29.69 cM
• Refseq Size: 842
• Refseq ORF: 588
• Synonyms: Cd27l; CD27LG; Tnfsf7; Tnlg8a
• Summary: Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.[UniProtKB/Swiss-Prot Function]