Bmp6 (NM_007556) Mouse Recombinant Protein

CAT#: TP525853

Purified recombinant protein of Mouse bone morphogenetic protein 6 (Bmp6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR225853 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPGLGRRAQWLCWWWGLLCSCGPPPLRPPLPVAAAAAGGQLLGAGGSPVRAEQPPPQSSSSGFLYRRLKT
  HEKREMQKEILSVLGLPHRPRPLHGLQQPQPPVLPPQQQQQQQQQQTAREEPPPGRLKSAPLFMLDLYNA
  LSNDDEEDGASEGVGQEPGSHGGASSSQLRQPSPGAAHSLNRKSLLAPGPGGGASPLTSAQDSAFLNDAD
  MVMSFVNLVEYDKEFSPHQRHHKEFKFNLSQIPEGEAVTAAEFRVYKDCVVGSFKNQTFLISIYQVLQEH
  QHRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGLHVNPRAAGLVGRDGPY
  DKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVSRGSGSSDYNGSELKTACKKHELYVSFQD
  LGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDD
  NSNVILKKYRNMVVRACGCH
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 56.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_031582
• Locus ID: 12161
• UniProt ID: P20722, Q3UXB2, Q8BRW3
• Cytogenetics: 13 18.15 cM
• Refseq Size: 2410
• Refseq ORF: 1533
• Synonyms: D13Wsu115; D13Wsu115e; Vg; Vgr1
• Summary: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates a wide range of biological processes including iron homeostasis, fat and bone development, and ovulation. Mice lacking this gene exhibit delayed ossification of the sternum, iron overload, and reduced fertility in females. [provided by RefSeq, Jul 2016]