Cd74 (NM_010545) Mouse Recombinant Protein

CAT#: TP525627

Purified recombinant protein of Mouse CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated) (Cd74), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR225627 representing NM_010545
  Red=Cloning site Green=Tags(s)
  
  MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLAGQATTAYFLYQQQGRLDKLTITSQN
  LQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQL
  KGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQEL
  GQVTL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 24.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034675
• Locus ID: 16149
• UniProt ID: Q545Y5
• Cytogenetics: 18 34.41 cM
• Refseq Size: 1239
• Refseq ORF: 645
• Synonyms: CLIP; DHLAG; HLADG; Ia-GAMMA; Ii
• Summary: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place. Enhance also the stimulation of T-cell responses through interaction with CD44.[UniProtKB/Swiss-Prot Function]