G0s2 (NM_008059) Mouse Recombinant Protein

CAT#: TP525376

Purified recombinant protein of Mouse G0/G1 switch gene 2 (G0s2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR225376 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MESVQELIPLAKEMMAQKPRGKLVKLYVLGSVLALFGVVLGLVETVCSPFTAASRLRDQEAAVVELREAC
  EQQSLHKQALLAGGKAQEATLCSRALSLRQHAS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 11.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032085
• Locus ID: 14373
• UniProt ID: Q61585, Q545U0
• Cytogenetics: 1 97.69 cM
• Refseq Size: 847
• Refseq ORF: 312
• Synonyms: AI255151; AV006465
• Summary: Promotes apoptosis by binding to BCL2, hence preventing the formation of protective BCL2-BAX heterodimers.[UniProtKB/Swiss-Prot Function]