Grn (NM_008175) Mouse Recombinant Protein

CAT#: TP525358

Purified recombinant protein of Mouse granulin (Grn), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR225358 representing NM_008175
  Red=Cloning site Green=Tags(s)
  
  MPPREPGPRRRQTMWVLMSWLAFAAGLVAGTQCPDGQFCPVACCLDQGGANYSCCNPLLDTWPRITSHHL
  DGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSCFQMSDNPLGAVQCPG
  SQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKFPAQKTNR
  AVSLPFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTD
  LLTKLPGYPVKEVKCDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGI
  LQVPWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFT
  CLAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQ
  HCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVECGEGHFCHDNQTCCKDSAGVWACCPYLKGVC
  CRDGRHCCPGGFHCSARGTKCLRKKIPRWDMFLRDPVPRPLL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 65.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032201
• Locus ID: 14824
• UniProt ID: P28798, Q3U9N4, Q544Y8, Q9D2V3
• Cytogenetics: 11 66.29 cM
• Refseq Size: 2348
• Refseq ORF: 1806
• Synonyms: epithelin; Pgrn
• Summary: Secreted proteins that act as key regulator of lysosomal function and as a growth factor involved in inflammation, wound healing and cell proliferation (PubMed:28073925, PubMed:8496151, PubMed:28541286, PubMed:28453791, PubMed:20026663, PubMed:23041626, PubMed:27789271, PubMed:12524533). Functions as regulator of proteins trafficking to lysosome and activity of lysosomal enzymes (PubMed:28453791, PubMed:28541286, PubMed:27789271). Facilitates also the acidification of lysosomes, causing degradation of mature CTSD by CTSB (PubMed:28073925). In addition, functions as wound-related growth factor that acts directly on dermal fibroblasts and endothelial cells to promote division, migration and the formation of capillary-like tubule structure (PubMed:12524533). Also promotes epithelial cell proliferation by blocking TNF-mediated neutrophil activation preventing release of oxidants and proteases (PubMed:8496151). Moreover, modulates inflammation in neuron by preserving neuron survival, axonal outgrowth and neuronal integrity (PubMed:23041626, PubMed:20026663).[UniProtKB/Swiss-Prot Function]