Tirap (NM_054096) Mouse Recombinant Protein

CAT#: TP525270

Purified recombinant protein of Mouse toll-interleukin 1 receptor (TIR) domain-containing adaptor protein (Tirap), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR225270 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASSSSVPASSTPSKKPRDKIADWFRQALLKKPKKMPISQESHLYDGSQTATQDGLSPSSCSSPPSHSSP
  ESRSSPSSCSSGMSPTSPPTHVDSSSSSSGRWSKDYDVCVCHSEEDLEAAQELVSYLEGSQASLRCFLQL
  RDAAPGGAIVSELCQALSRSHCRALLITPGFLRDPWCKYQMLQALTEAPASEGCTIPLLSGLSRAAYPPE
  LRFMYYVDGRGKDGGFYQVKEAVIHYLETLS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 26 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_473437
• Locus ID: 117149
• UniProt ID: Q99JY1, Q542S6, H3BKL1
• Cytogenetics: 9 A4
• Refseq Size: 4741
• Refseq ORF: 726
• Synonyms: AA407980; C130027E04Rik; Mal; Tlr4ap; Wyatt
• Summary: Adapter involved in the TLR2 and TLR4 signaling pathways in the innate immune response. Acts via IRAK2 and TRAF-6, leading to the activation of NF-kappa-B, MAPK1, MAPK3 and JNK, and resulting in cytokine secretion and the inflammatory response (By similarity). Positively regulates the production of TNF-alpha and interleukin-6 (By similarity).[UniProtKB/Swiss-Prot Function]