OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cracr2a (NM_001033464) Mouse Recombinant Protein

Be the first to review this product
SKU
TP524950
Purified recombinant protein of Mouse calcium release activated channel regulator 2A (Cracr2a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Cracr2a or NM_001033464"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR224950 representing NM_001033464
Red=Cloning site Green=Tags(s)

MATPSGREDSSSQTPGHGKQGSGACVEQLDHPEKLEVEMPDQSAMWKKAQEFFQTCDSEGKGFIARTDMQ
RLHQELPLSLEELEDVFDALDADGNGFLTPEEFTTGFSHFFFSQNIQGEEEADQQVAQLQEEKVYQSRGE
EDVGDMDHDEEAQFQMLMDRLGAQKVLEDESDVRQLWLQLRKDEPHLLSNFEDLLTTIFAQLQEAHEQKN
ELECALRKKIAAYDEEIQHLYEEMEQQIKSEREQFLLKDTERFQARSRELEKKLSAKEQELERLNQKQRK
VGYCGDIVGPQLFQLSLPLPHALHHSSMDF

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 35.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001028636
Locus ID 381812
UniProt ID Q3UP38
Cytogenetics 6 F3
RefSeq Size 1094
RefSeq ORF 930
Synonyms Efcab4b; Gm462; Gm1073
Summary Ca(2+)-binding protein that plays a key role in store-operated Ca(2+) entry (SOCE) in T-cells by regulating CRAC channel activation. Acts as a cytoplasmic calcium-sensor that facilitates the clustering of ORAI1 and STIM1 at the junctional regions between the plasma membrane and the endoplasmic reticulum upon low Ca(2+) concentration. It thereby regulates CRAC channel activation, including translocation and clustering of ORAI1 and STIM1. Upon increase of cytoplasmic Ca(2+) resulting from opening of CRAC channels, dissociates from ORAI1 and STIM1, thereby destabilizing the ORAI1-STIM1 complex (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products