OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Tm4sf20 (NM_025453) Mouse Recombinant Protein

Be the first to review this product
SKU
TP524367
Purified recombinant protein of Mouse transmembrane 4 L six family member 20 (Tm4sf20), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Tm4sf20 or NM_025453"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR224367 representing NM_025453
Red=Cloning site Green=Tags(s)

MTCCEGWTSCNGFSLLILILLGVVINCIPLGISLVEADSTSQNPISCYEWWFPGIIGAGLMAIPATTMSL
AARKRACCNNKTGMFLSSLFSVITVVGAVYCMLVSLQALLEGPLICNTQANSTVTCEFSLKNLSKFDPES
FNLLWFFNGTCVSPTDFKNPTINNMVSNWKIPNSNSEEDRHRIFHFSVFMSLLLVGILELLFGLSQILIG
FLGCLCGVSQRRSQIV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 25.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_079729
Locus ID 66261
UniProt ID Q9CQY8
Cytogenetics 1 C5
RefSeq Size 1503
RefSeq ORF 678
Synonyms 1810018L02Rik
Summary Polytopic transmembrane protein. Inhibits regulated intramembrane proteolysis (RIP) of CREB3L1, inhibiting its activation and the induction of collagen synthesis. In response to ceramide, which alters TM4SF20 membrane topology, stimulates RIP activation of CREB3L1. Ceramide reverses the direction through which transmembrane helices are translocated into the endoplasmic reticulum membrane during translation of TM4SF20, this mechanism is called 'regulated alternative translocation' (RAT) and regulates the function of the transmembrane protein.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products