OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Zadh2 (NM_146090) Mouse Recombinant Protein

Be the first to review this product
SKU
TP524314
Purified recombinant protein of Mouse zinc binding alcohol dehydrogenase, domain containing 2 (Zadh2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Zadh2 or NM_146090"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR224314 representing NM_146090
Red=Cloning site Green=Tags(s)

MLRLAAAGARAIVDMSYARHFLDFQGSAIPRTMQKLVVTRLSPNFHEAVTLRRDCPVPLPGDGDLLVRNR
FVGINASDINYSAGRYDPSLKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIA
IPMPSVKPEYLTMLVSGTTAYLSLEELGELSEGKKVLVTAAAGGTGQFAVQLSKIAKCHVIGTCSSDEKA
AFLKSIGCDRPINYRTEPVETVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQSPTG
LSPIKAGVLPTKLLKKSASLRGFFLNHYFSKYQAAMERLLELYARGDLVCEVDLGHLAPDGRFIGLESVF
QAVDYMYTGKNTGKLVVELPHPVSSKL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 41 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_666202
Locus ID 225791
UniProt ID Q8BGC4
Cytogenetics 18 E4
RefSeq Size 3321
RefSeq ORF 1131
Synonyms C530046K17Rik; PTGR-3; Pthr3
Summary Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-keto-PGE1, 15-keto-PGE2, 15-keto-PGE1-alpha and 15-keto-PGE2-alpha with highest efficienty towards 15-keto-PGE2-alpha. Overexpression represses transcriptional activity of PPARG and inhibits adipocyte differentiation.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Prostaglandin reductase-3 negatively modulates adipogenesis through regulation of PPARγ activity
Yu, Chang, Su et al
J. Lipid Res. (2013) 54 (9), 2391-9 DOI: 10.1194/jlr.M037556
AI Summary: OriGene products contributed to this study by providing the mouse PTGR-3 cDNA (Flag-PTGR-3) expression vector and control empty vector, which were used to manipulate PTGR-3 expression and investigate its role in adipogenesis.
Snippet: California San Diego, La Jolla, CA). Mouse PTGR-3 cDNA (Flag-PTGR-3) expression vector and control empty vector were purchased from OriGene (Rockville, MD). Lentiviral infection. Small hairpin RNA (shRNA) plasmids for
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products