OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Gldn (NM_177350) Mouse Recombinant Protein

Be the first to review this product
SKU
TP524196
Purified recombinant protein of Mouse gliomedin (Gldn), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Gldn or NM_177350"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR224196 representing NM_177350
Red=Cloning site Green=Tags(s)

MTRAAERGQGATGWGLRGALVAIALLSALNAAGTVFVLCQWRGLSAALRALEAQRGREQREDSALRAFLA
ELSRAPGRVPEPSQDPMSAARNKRSHNGEPASHIRAESQDMMMMMTYSMVPIRVMIDLCNSTQGICLTGP
PGPPGPPGAGGLPGHNGSDGQPGLQGPKGEKGAIGKRGKMGLPGATGNPGEKGEKGDAGELGLPGNEGPP
GQKGDKGDKGDVSNDVLLTGAKGDQGPPGPPGPPGPPGPPGSRRSKGPRPPNVFNSQCPGETCVIPNDDT
LVGRADEKANERHSPQTESMITSIGNPAQVLKVRETFGTWMRESANKSDDRIWVTEHFSGIMVKEFKDLP
ALLNSSFTLLHLPHYFHGCGHAVYNNSLYYHKGGSNTIVRFEFGKETPQTLKLENALYFDRKYLFANSKT
YFNIAVDEKGIWIIYASSVDGSSILVAQLDERTFSVTQHINTTYPKSKAGNAFIARGILYVTDTKDTRVT
FAFDLLGGKQINANFDFRMSQSVLAMLSYNMRDQHLYSWEDGHLMLYPVQFLSAASSQR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 59.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_796324
Locus ID 235379
UniProt ID Q8BMF8
Cytogenetics 9 A5.3
RefSeq Size 4649
RefSeq ORF 1647
Synonyms Clom; Colm; CRG-L2; Crgl2; Crlg2
Summary Ligand for NRCAM and NFASC/neurofascin that plays a role in the formation and maintenance of the nodes of Ranvier on myelinated axons. Mediates interaction between Schwann cell microvilli and axons via its interactions with NRCAM and NFASC (PubMed:20188654). Nodes of Ranvier contain clustered sodium channels that are crucial for the saltatory propagation of action potentials along myelinated axons. During development, nodes of Ranvier are formed by the fusion of two heminodes. Required for normal clustering of sodium channels at heminodes; not required for the formation of mature nodes with normal sodium channel clusters (PubMed:20188654). Required, together with NRCAM, for maintaining NFASC and sodium channel clusters at mature nodes of Ranvier (PubMed:24719088).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products