OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Rnd1 (NM_172612) Mouse Recombinant Protein

Be the first to review this product
SKU
TP524149
Purified recombinant protein of Mouse Rho family GTPase 1 (Rnd1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Rnd1 or NM_172612"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR224149 representing NM_172612
Red=Cloning site Green=Tags(s)

MKERRAPQPVVVRCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSG
SPYYDNVRPLCYSDSDAVLLCFDISRPETMDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELS
HQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSETSIHSIFRTASMVCLNKSSPVPPKSPVRSLSKRLLHL
PSRSELISTTFKKEKAKSCSIM

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 26.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_766200
Locus ID 223881
UniProt ID Q8BLR7
Cytogenetics 15 F1
RefSeq Size 2203
RefSeq ORF 696
Synonyms A830014L09Rik; Arhs
Summary Lacks intrinsic GTPase activity. Has a low affinity for GDP, and constitutively binds GTP. Controls rearrangements of the actin cytoskeleton. Induces the Rac-dependent neuritic process formation in part by disruption of the cortical actin filaments. Causes the formation of many neuritic processes from the cell body with disruption of the cortical actin filaments (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Growth Factors, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products