B3glct (NM_001081204) Mouse Recombinant Protein

CAT#: TP523990

Purified recombinant protein of Mouse beta-3-glucosyltransferase (B3glct), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR223990 representing NM_001081204
  Red=Cloning site Green=Tags(s)
  
  MRPPALLALFSCSAAFALMSEEIKEKVTPSQDLRQSSLPGRHDIDLKEIVFVIQSQSNSFHAKRAEQLKK
  NILKQAANLTQDLPRVLLLHQLAKQEGAWTILPLLPHFSVTYSKNSAWIFFCEEETRLQIPRLLDTLRRY
  DPSKEWFLGKALYDEESTIIHHYAFSENPTVFKYPDFAAGWALSIPLVNKLAKRLKSEALKSDFTIDLKH
  EIALYIWDKGGGPALTPVPEFCTEDVDPRCVTTFHSFLPLCGVPVKKEEIFVAVKTCKKFHADRIPIVKK
  TWAAQASLIEYYSDYAETAIPTVDLGIPNTDRGHCGKTFAILEKFLNHSHNKISWLVIVDDDTLISISRL
  RHLLSCYDSSDPVFLGERYGYGLGTGGYSYVTGGGGMVFSREAIRRLLVSSCRCYSNDAPDDMVLGMCFS
  GLGVPVTHSPLFHQARPVDYPKDYLAHQIPVSFHKHWHIDPVKVYLTWLAPSEEDQATQETQKDPREEL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 55.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001074673
• Locus ID: 381694
• UniProt ID: Q8BHT6
• Cytogenetics: 5 G3
• Refseq Size: 4543
• Refseq ORF: 1467
• Synonyms: B3galtl; Gm1057
• Summary: O-glucosyltransferase that transfers glucose toward fucose with a beta-1,3 linkage. Specifically glucosylates O-linked fucosylglycan on TSP type-1 domains of proteins, thereby contributing to elongation of O-fucosylglycan (By similarity).[UniProtKB/Swiss-Prot Function]