OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

B3glct (NM_001081204) Mouse Recombinant Protein

Be the first to review this product
SKU
TP523990
Purified recombinant protein of Mouse beta-3-glucosyltransferase (B3glct), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "B3glct or NM_001081204"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR223990 representing NM_001081204
Red=Cloning site Green=Tags(s)

MRPPALLALFSCSAAFALMSEEIKEKVTPSQDLRQSSLPGRHDIDLKEIVFVIQSQSNSFHAKRAEQLKK
NILKQAANLTQDLPRVLLLHQLAKQEGAWTILPLLPHFSVTYSKNSAWIFFCEEETRLQIPRLLDTLRRY
DPSKEWFLGKALYDEESTIIHHYAFSENPTVFKYPDFAAGWALSIPLVNKLAKRLKSEALKSDFTIDLKH
EIALYIWDKGGGPALTPVPEFCTEDVDPRCVTTFHSFLPLCGVPVKKEEIFVAVKTCKKFHADRIPIVKK
TWAAQASLIEYYSDYAETAIPTVDLGIPNTDRGHCGKTFAILEKFLNHSHNKISWLVIVDDDTLISISRL
RHLLSCYDSSDPVFLGERYGYGLGTGGYSYVTGGGGMVFSREAIRRLLVSSCRCYSNDAPDDMVLGMCFS
GLGVPVTHSPLFHQARPVDYPKDYLAHQIPVSFHKHWHIDPVKVYLTWLAPSEEDQATQETQKDPREEL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 55.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001074673
Locus ID 381694
UniProt ID Q8BHT6
Cytogenetics 5 G3
RefSeq Size 4543
RefSeq ORF 1467
Synonyms B3galtl; Gm1057
Summary O-glucosyltransferase that transfers glucose toward fucose with a beta-1,3 linkage. Specifically glucosylates O-linked fucosylglycan on TSP type-1 domains of proteins, thereby contributing to elongation of O-fucosylglycan (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Unusual life cycle and impact on microfibril assembly of ADAMTS17, a secreted metalloprotease mutated in genetic eye disease
Hubmacher, Schneider, Berardinelli et al
Sci Rep (2017) 7, 41871 DOI: 10.1038/srep41871
AI Summary: OriGene’s pENTR223.1-ADAMTS17 synthetic DNA clone was used to generate a recombinant full-length, Myc/His-tagged human ADAMTS17 expression plasmid, enabling the study of ADAMTS17’s role in microfibril assembly in this paper.
Snippet: To generate a recombinant full-length, Myc/His-tagged human ADAMTS17 expression plasmid, a 1970 bp NotI × EcoRI fragment was excised from a synthetic DNA clone pENTR223.1-ADAMTS17 (NCBI RefSeq: XM_017021975, OriGene, Rockville, MD) and ligated into NotI × EcoRI digested pcDNA3.1/MycHis (-) A (Invitrogen, San Diego, CA), which was named pcDNA-TS17 Not_Eco
FigureFigureFigure
ISH
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products