Setmar (NM_178391) Mouse Recombinant Protein

CAT#: TP523932

Purified recombinant protein of Mouse SET domain without mariner transposase fusion (Setmar), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR223932 representing NM_178391
  Red=Cloning site Green=Tags(s)
  
  MSAEGVEKLSLEIAASEEESVAPTEQQDVACGLENLPVSLWPLGAEPRPKPFQYTPDHVAGPGADIDPTQ
  ITFPGCACIETPCVPGTCSCLRHENNYDDNLCLRDVGSEGKYAKPVFECNVLCQCGMRCRNRVVQNGLHF
  LLQVFQTEKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTSHDSNYIIAVREHIYSGQIMETF
  VDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDILPGEELSYDYSGRFLNQVSSKDKEKID
  CSPPRKPCYCGAQSCTTFLPYDSSLYMAP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 34.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_848478
• Locus ID: 74729
• UniProt ID: Q80UJ9
• Cytogenetics: 6 E1
• Refseq Size: 1617
• Refseq ORF: 927
• Synonyms: 5830404F24Rik; Etet2
• Summary: This gene encodes a histone-lysine N-methyltransferase that may be involved in the methylation of histone H3. In anthropoid primates this gene is a fusion gene of a SET histone-lysine N-methyltransferase and a mariner (MAR) family transposase. In all other species this gene contains only the SET domain. [provided by RefSeq, Jan 2013]