OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Setmar (NM_178391) Mouse Recombinant Protein

Be the first to review this product
SKU
TP523932
Purified recombinant protein of Mouse SET domain without mariner transposase fusion (Setmar), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Setmar or NM_178391"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR223932 representing NM_178391
Red=Cloning site Green=Tags(s)

MSAEGVEKLSLEIAASEEESVAPTEQQDVACGLENLPVSLWPLGAEPRPKPFQYTPDHVAGPGADIDPTQ
ITFPGCACIETPCVPGTCSCLRHENNYDDNLCLRDVGSEGKYAKPVFECNVLCQCGMRCRNRVVQNGLHF
LLQVFQTEKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTSHDSNYIIAVREHIYSGQIMETF
VDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDILPGEELSYDYSGRFLNQVSSKDKEKID
CSPPRKPCYCGAQSCTTFLPYDSSLYMAP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 34.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_848478
Locus ID 74729
UniProt ID Q80UJ9
Cytogenetics 6 E1
RefSeq Size 1617
RefSeq ORF 927
Synonyms 5830404F24Rik; Etet2
Summary This gene encodes a histone-lysine N-methyltransferase that may be involved in the methylation of histone H3. In anthropoid primates this gene is a fusion gene of a SET histone-lysine N-methyltransferase and a mariner (MAR) family transposase. In all other species this gene contains only the SET domain. provided by RefSeq, Jan 2013
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products