Lbx1 (NM_010691) Mouse Recombinant Protein

CAT#: TP523760

Purified recombinant protein of Mouse ladybird homeobox 1 (Lbx1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR223760 representing NM_010691
  Red=Cloning site Green=Tags(s)
  
  MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAPGG
  LPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYEL
  EKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAE
  LEQNSEASGGGGGGGCGRAKSRPGSPALPPGAPQAPGGGPLQLSPASPLTDQRASSQDCSEDEEDEEIDV
  DD
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 30.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034821
• Locus ID: 16814
• UniProt ID: P52955
• Cytogenetics: 19 C3
• Refseq Size: 864
• Refseq ORF: 846
• Synonyms: Lbx1h
• Summary: Transcription factor required for the development of GABAergic interneurons in the dorsal horn of the spinal cord and migration and further development of hypaxial muscle precursor cells for limb muscles, diaphragm and hypoglossal cord.[UniProtKB/Swiss-Prot Function]