Map2k2 (NM_023138) Mouse Recombinant Protein

CAT#: TP523494

Purified recombinant protein of Mouse mitogen-activated protein kinase kinase 2 (Map2k2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR223494 representing NM_023138
  Red=Cloning site Green=Tags(s)
  
  MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELDLDEQQRKRLEAFLTQKAKVGELKDD
  DFERISELGAGNGGVVTKARHRPSGLIMARKLIHLEIKPAVRNQIIRELQVLHECNSPYIVGFYGAFYSD
  GEISICMEHMDGGSLDQVLKEAKRIPEDILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKL
  CDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFG
  RPVVDGADGEPHSVSPRPRPPGRPISVGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFSSDFQEFVNKC
  LIKNPAERADLKLLMNHAFIKRSEGEEVDFAGWLCRTLRLKQPSTPTRTAV
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 44.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_075627
• Locus ID: 26396
• UniProt ID: Q63932, Q8CB46
• Cytogenetics: 10 39.72 cM
• Refseq Size: 2387
• Refseq ORF: 1203
• Synonyms: AA589381; MEK2; MK2; Prkmk2
• Summary: Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in a Thr-Glu-Tyr sequence located in MAP kinases. Activates the ERK1 and ERK2 MAP kinases.[UniProtKB/Swiss-Prot Function]