OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Fuz (NM_027376) Mouse Recombinant Protein

Be the first to review this product
SKU
TP523378
Purified recombinant protein of Mouse fuzzy planar cell polarity protein (Fuz), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Fuz or NM_027376"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR223378 representing NM_027376
Red=Cloning site Green=Tags(s)

MGDEGPGSPVHLLCLAASSGVPLFCRSSSGGAPSRQQLPFSVIGSLNGVHMFGQNLDVQLNSARTEDTTV
VWKNFHDSITLIVLSSEEGTSELRLERMLHMVFGAMVLIVGLEELTNIRNVERLKKELRASYCLIDSFLG
NSELIGDLTQCVDCVIPPEGSAMQETLSGFAEATGTAFVSLLVSGRVVAATEGWWRLGMPEAVLLPWLVG
SLPPQAARDYPVYLPHGSPTVPHRLLTLTLLRGLELCLLCGPRPPLGQLDPQLMERWWQPLLEPLRACLP
LGPRALPEGFPLHSDILGLLLLHLELRRCLFTVEPSKDKEPSPEQRRRLLRNFYTLVATTHFPPEPGPAE
KQEDTVYPAQMPRACYLVLGPGMGWQLVAVQLGLRLLLLLLSPHTPTHGLRSLATRTLQALTPLL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 46 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_081652
Locus ID 70300
UniProt ID Q3UYI6
Cytogenetics 7 28.99 cM
RefSeq Size 1715
RefSeq ORF 1245
Synonyms 2600013E07Rik; b2b1273Clo
Summary Probable planar cell polarity effector involved in cilium biogenesis. May regulate protein and membrane transport to the cilium. Proposed to function as core component of the CPLANE (ciliogenesis and planar polarity effectors) complex involved in the recruitment of peripheral IFT-A proteins to basal bodies (PubMed:19877275, PubMed:19767740, PubMed:27158779). May regulate the morphogenesis of hair follicles which depends on functional primary cilia (PubMed:20962855).UniProtKB/Swiss-Prot Function
Protein Categories Growth Factors, Intracellular Proteins, Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products