Tnnt2 (NM_001130179) Mouse Recombinant Protein

CAT#: TP523331

Purified recombinant protein of Mouse troponin T2, cardiac (Tnnt2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Tnnt2 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR223331 representing NM_001130179
  Red=Cloning site Green=Tags(s)
  
  MPCPQPVPAEAEQIPQDLCAVPVQRAESMSDAEEVVEEYEEEQEEAVEEQEEAVEEEEAGGAEPEPEGEA
  ETEEANVEEVGPDEEAKDAEEGPVEDTKPKPSRLFMPNLVPPKIPDGERVDFDDIHRKRVEKDLNELQTL
  IEAHFENRKKEEEELISLKDRIEKRRAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKK
  KALSNMMHFGGYIQKQAQTERKSGKRQTEREKKKKILAERRKALAIDHLNEDQLREKAKELWQSIHNLEA
  EKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 38.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001123651
• Locus ID: 21956
• UniProt ID: P50752
• Cytogenetics: 1 59.32 cM
• Refseq Size: 1177
• Refseq ORF: 969
• Synonyms: cTnT; Tnt
• Summary: Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.[UniProtKB/Swiss-Prot Function]