OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Bmp3 (NM_173404) Mouse Recombinant Protein

Be the first to review this product
SKU
TP523213
Purified recombinant protein of Mouse bone morphogenetic protein 3 (Bmp3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Bmp3 or NM_173404"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR223213 protein sequence
Red=Cloning site Green=Tags(s)

MAGARGLLCLWLGYFCLNLAQGQRPNLHLPGLRETEPSDRATGGSPSPDLRPHDKVSEHMLWLYDRYSGS
SRVQATRTPGSQLPGPQPLRGGNTVRSFRAAAAGTPQTKGLHTFNLTSLTKSENILSATLYFYVGELVNI
SLSCPEPQGCSHHTQRQHIQIDLSAWILKSNQSQLLGHLSVDVVRPYRDSVSWLSKDITQLLRKAKQNEE
FLIGFNITSRAHELPKRMLFFPEPYILVYANDAAISEPESVVSSLQRHRDFTAGTGPRLDSHVREALSVE
RRKKRSTGILLPLQNNELPGAEYQYKEEGAWEERKPYKSLQTQPPEKSRNKKKQRKGSHQKGQTLQFDEQ
TLKKARRKQWVEPRNCARRYLKVDFADIGWSEWIISPKSFDAFYCSGACQFPMPKSLKPSNHATIQSIVR
AVGVVSGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVDSCACR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 52.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_775580
Locus ID 110075
UniProt ID Q8BHE5
Cytogenetics 5 48.24 cM
RefSeq Size 3112
RefSeq ORF 1404
Synonyms 9530029I04Rik; D630004D15R
Summary This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein suppresses osteoblast differentiation, and negatively regulates bone density, by modulating TGF-beta receptor availability to other ligands. Homozygous knockout mice for this gene exhibit increased bone density and volume, while overexpression of this gene in a transgenic mouse causes bone defects resulting in spontaneous rib fractures. This gene encodes distinct protein isoforms that may be similarly proteolytically processed. provided by RefSeq, Jul 2016
Protein Categories Cytokines, Growth Factors, Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products