S1pr2 (NM_010333) Mouse Recombinant Protein

CAT#: TP523211

Purified recombinant protein of Mouse sphingosine-1-phosphate receptor 2 (S1pr2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR223211 representing NM_010333
  Red=Cloning site Green=Tags(s)
  
  MGGLYSEYLNPEKVLEHYNYTKETLDMQETTSRKVASAFIIILCCAIVVENLLVLIAVARNSKFHSAMYL
  FLGNLAASDLLAGVAFVANTLLSGHVTLSLTPVQWFAREGSAFITLSASVFSLLAIAIERQVALAKVKLY
  GSDKSCRMLMLIGASWLISLILGGLPILGWNCLNQLEACSTVLPLYAKHYVLCVVTIFSVILLAIVALYV
  RIYFVVRSSHADVAGPQTLALLKTVTIVLGVFIICWLPAFSILLLDSTCPVRACPVLYKAHYFFAFATLN
  SLLNPVIYTWRSRDLRREVLRPLQCWRRGKGVTGRRGGNPGHRLLPLRSSSSLERGMHMPTSPTFLEGNT
  VV
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 39.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034463
• Locus ID: 14739
• UniProt ID: P52592
• Cytogenetics: 9 7.68 cM
• Refseq Size: 2815
• Refseq ORF: 1056
• Synonyms: 1100001A16Rik; Edg5; Gpcr13; H218; LPb2; S1P2
• Summary: Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P) (By similarity). S1P is a bioactive lysophospholipid that elicits diverse physiological effects on most types of cells and tissues (By similarity). Receptor for the chemokine-like protein FAM19A5 (By similarity). Mediates the inhibitory effect of FAM19A5 on vascular smooth muscle cell proliferation and migration (By similarity).[UniProtKB/Swiss-Prot Function]