OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Tbx19 (NM_032005) Mouse Recombinant Protein

Be the first to review this product
SKU
TP522567
Purified recombinant protein of Mouse T-box 19 (Tbx19), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Tbx19 or NM_032005"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR222567 protein sequence
Red=Cloning site Green=Tags(s)

MSELATQKAGEGTVSRLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNEMIVTKNGRRMFP
VLKISVTGLDPNAMYSLLLDFVRTDSHRWKYVNGEWVPAGKPEVSSHSCVYIHPDSPNFGAHWMKAPISF
SKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGGAHRMVMNCSFPETQFIAVTAYQNEEITALKIKYNPF
AKAFLDAKERNHLKDVPEAISESQHVTYSHLGGWILSNPDGVCTAANSNYQYATPLPLPAPHTHHGCEHY
AGLRGHRQAPYPSAYMHRNHSPSVNLIESSSNNLQVFSGPDSWTSLSSTPHASILSVPHSNGPINPGPSP
YPCLWTISNGGGGPVASGSEVHASTSGTILLGNPAVTSPSSLLPTQATTSAGVEVLGEPSLTSIAVSTWT
AVASHPLPGWGGPGGAGRHSSSSLDS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 48 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_114394
Locus ID 83993
UniProt ID Q99ME7
Cytogenetics 1 72.47 cM
RefSeq Size 2662
RefSeq ORF 1338
Synonyms AU019250; D1Ertd754; D1Ertd754e; Tp; Tpit
Summary This gene encodes a member of a family of transcription factors containing a characteristic T-box DNA-binding domain. The encoded protein promotes expression of the pro-opiomelanocortin (POMC) gene, which is important for the differentiation of cells in the pituitary gland. provided by RefSeq, Mar 2013
Protein Categories Endocrine and metabolic diseases, Intracellular Proteins, Transciption Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Aberrant expression of the embryonic transcription factor brachyury in human tumors detected with a novel rabbit monoclonal antibody
Hamilton, Fernando, Schlom et al
Oncotarget (2015) 6 (7), 4853-62 DOI: 10.18632/oncotarget.3086
Cited by 32
AI Summary: OriGene products contributed to this study by providing the brachyury cDNA (OriGene, SC119705) and brachyury shRNA (OriGene, TF314919) used for overexpression and knockdown experiments to validate the specificity of the novel rabbit monoclonal antibody against brachyury.
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products