Cycs (NM_007808) Mouse Recombinant Protein

CAT#: TP522141

Purified recombinant protein of Mouse cytochrome c, somatic (Cycs), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR222141 representing NM_007808
  Red=Cloning site Green=Tags(s)
  
  MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLE
  NPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 12.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_031834
• Locus ID: 13063
• UniProt ID: P62897, Q56A15
• Cytogenetics: 6 24.32 cM
• Refseq Size: 3059
• Refseq ORF: 315
• Summary: Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.[UniProtKB/Swiss-Prot Function]